PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c3_17650V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NF-YC
Protein Properties Length: 175aa    MW: 19759.8 Da    PI: 4.7066
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c3_17650V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC165.76e-522968102
              NF-YC   8 kqiekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                        +++e+++dfk h+lPlarikki+k+dedvkmi+aeaPvl+skace+fileltlrsw+h+eenkrrtl+++dia a+tr difdflvdivprd
  Pp3c3_17650V3.2.p   2 QEMEQVNDFKTHQLPLARIKKIMKSDEDVKMIAAEAPVLFSKACEMFILELTLRSWIHTEENKRRTLQRNDIAGAITRGDIFDFLVDIVPRD 93 
                        67****************************************************************************************** PP

              NF-YC 100 elk 102
                        elk
  Pp3c3_17650V3.2.p  94 ELK 96 
                        975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471131.34E-30286IPR009072Histone-fold
Gene3DG3DSA:1.10.20.104.3E-37578IPR009072Histone-fold
PfamPF008081.8E-211477IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 175 aa     Download sequence    Send to blast
MQEMEQVNDF KTHQLPLARI KKIMKSDEDV KMIAAEAPVL FSKACEMFIL ELTLRSWIHT  60
EENKRRTLQR NDIAGAITRG DIFDFLVDIV PRDELKEEDL GVPWSGVPGI PAEGVQYGGM  120
YYPPMPGQPM HHPMGAPEMM VGQPGMPPNP QMMYQPPPAA FAPEQQQQQQ QQMQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_C2e-44792994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT GAMMA
4csr_B2e-44792994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT GAMMA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16470RRTLQRN
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.121860.0gametophore| protonema| sporophyte
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322264.22e-68hypothetical protein POPTR_0015s10940g
RefseqXP_011023993.11e-68PREDICTED: nuclear transcription factor Y subunit C-1-like
SwissprotQ9SMP07e-66NFYC1_ARATH; Nuclear transcription factor Y subunit C-1
TrEMBLA9NUT08e-70A9NUT0_PICSI; Putative uncharacterized protein
STRINGPP1S315_9V6.31e-125(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56170.23e-60nuclear factor Y, subunit C2